PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do002280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family BBR-BPC
Protein Properties Length: 371aa    MW: 40730 Da    PI: 10.4754
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do002280.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind341.32.3e-10413711301
   GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssiaerdaki.................rernlalsekkaavaerd.......................m 58 
                 mdddgs   rn+g+ye     k nlglqlms   +rd+k+                 +++++  +++++++++r                        m
  Do002280.1   1 MDDDGSLGiRNWGFYETM---KGNLGLQLMSPP-DRDTKPllpngsnflqhhghhnaQQQHQHQHHPQHSHHPRGgggggggsssapggmpteptavhM 95 
                 9*****999******965...*********986.9**************99888776566665666667777777************************ PP

   GAGA_bind  59 aflqrdkalae.......rnkalverdnkllalllvensla...........salpvgvqvlsgtksidslqqlse...............pqledsav 124
                 +f++++++l+        ++++ ++r++k+l+ l+v                +++p+g++++ +++ +++lq+++                pq +++++
  Do002280.1  96 DFVRNEAWLHPsqhhhqhHHQHQHPRQQKVLHHLPVGPVGHvghpghgghavHHHPTGYGMMADAHGVHTLQMMQPqaqpqpqpqpqpqpqPQPTPQPQ 194
                 *********98433222222334456666666666554433788999**9*99**********999999999844447799999988665533333333 PP

   GAGA_bind 125 e.lreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqC 222
                 +    +e++   p+ e ++++k+++ +kkrq++++pk+++ kk+kk  +++k++ ++++  +r + ++k++++v+ng++lD s++P+PvCsCtGa++qC
  Do002280.1 195 DpPVPKEESMPDPLIEDHPVIKNEPPVKKRQQGRQPKSPNPKKPKK-VAAPKENGAPNKPAPRPRGPRKTVGMVINGIDLDLSRIPTPVCSCTGAPQQC 292
                 33233445556667777899999999999*****************.56777777777766************************************** PP

   GAGA_bind 223 YkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                 Y+WG+GGWqSaCCtt+iS+yPLP+stkrrgaRiagrKmSqgafkk+LekLa+eGy+l+np+DLk++WAkHGtnkfvtir
  Do002280.1 293 YRWGAGGWQSACCTTSISTYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEGYNLANPIDLKTFWAKHGTNKFVTIR 371
                 ******************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012263.1E-1721371IPR010409GAGA-binding transcriptional activator
PfamPF062172.0E-1191371IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MDDDGSLGIR NWGFYETMKG NLGLQLMSPP DRDTKPLLPN GSNFLQHHGH HNAQQQHQHQ  60
HHPQHSHHPR GGGGGGGGSS SAPGGMPTEP TAVHMDFVRN EAWLHPSQHH HQHHHQHQHP  120
RQQKVLHHLP VGPVGHVGHP GHGGHAVHHH PTGYGMMADA HGVHTLQMMQ PQAQPQPQPQ  180
PQPQPQPQPT PQPQDPPVPK EESMPDPLIE DHPVIKNEPP VKKRQQGRQP KSPNPKKPKK  240
VAAPKENGAP NKPAPRPRGP RKTVGMVING IDLDLSRIPT PVCSCTGAPQ QCYRWGAGGW  300
QSACCTTSIS TYPLPMSTKR RGARIAGRKM SQGAFKKVLE KLAGEGYNLA NPIDLKTFWA  360
KHGTNKFVTI R
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1234240PKKPKKV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0983311e-150FP098331.1 Phyllostachys edulis cDNA clone: bphylf058a01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985070.11e-168PREDICTED: protein Barley B recombinant
RefseqXP_004985071.11e-168PREDICTED: protein Barley B recombinant
SwissprotQ8GUC31e-152BBR_HORVU; Protein Barley B recombinant
TrEMBLK4ABT01e-168K4ABT0_SETIT; Uncharacterized protein
STRINGSi036337m1e-167(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22113697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.34e-62basic pentacysteine 2